PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00601.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 299aa    MW: 32598.2 Da    PI: 8.8653
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00601.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.7e-381777262
                   zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             ++ +lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGg+ rknk+++
  Rsa1.0_00601.1_g00001.1 17 PQPQLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGSYRKNKRVK 77
                             56789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.1E-332075IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-272175IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9012175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MQSKNMIVAP SHQQQPPQPQ LKCPRCDSSN TKFCYYNNYS LSQPRHFCKA CKRYWTRGGT  60
LRNVPVGGSY RKNKRVKRPA TTTTIAATTV STTTSSCPNN PHHQISHFPS MNHHPLFYGL  120
SDQVSSCNNI PMFPSRFTDP SKTSSGLEGE FLSTGFNGLG LGLQHHMSHD QTISGSFISN  180
STTNKPFLPS GLFESSVSSS SSTLLQHPHK PMNNSGEIMG QSHLQTLASL QDLHVGGNNE  240
DVNKEGNLAE ISGNINGFMP SSSLDPSNYH NIWNNASVSS GAWLDPTNNI VGSSLTSLI
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0210440.0AC021044.5 Arabidopsis thaliana chromosome I BAC F3H9 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638451.11e-174PREDICTED: dof zinc finger protein DOF1.4
RefseqXP_013712677.11e-174PREDICTED: dof zinc finger protein DOF1.4-like
RefseqXP_013712954.11e-174PREDICTED: dof zinc finger protein DOF1.4-like
SwissprotQ9FZA41e-141DOF14_ARATH; Dof zinc finger protein DOF1.4
TrEMBLA0A078JYP51e-174A0A078JYP5_BRANA; BnaA09g53950D protein
TrEMBLA0A0D3CE831e-174A0A0D3CE83_BRAOL; Uncharacterized protein
STRINGBra032891.1-P1e-173(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47092650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-138Dof family protein